Recombinant Human T cell receptor beta constant 2 (TRBC2), partial
Catalog Number:
CSB-MP024292HU
- Images (0)
| Article Name: | Recombinant Human T cell receptor beta constant 2 (TRBC2), partial |
| Biozol Catalog Number: | CSB-MP024292HU |
| Supplier Catalog Number: | CSB-MP024292HU |
| Alternative Catalog Number: | CSB-MP024292HU-1, CSB-MP024292HU-100, CSB-MP024292HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | TCRBC2,CSB-PR2024 |
| Molecular Weight: | 43.6 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | A0A5B9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-129aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD |
Product Guarantee and Expert Support
