Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Catalog Number: CSB-MP024405HU
Article Name: Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial
Biozol Catalog Number: CSB-MP024405HU
Supplier Catalog Number: CSB-MP024405HU
Alternative Catalog Number: CSB-MP024405HU-1, CSB-MP024405HU-100, CSB-MP024405HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Triggering receptor expressed on monocytes 2,CSB-PR2024
Molecular Weight: 22.5 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9NZC2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 19-174aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS