Recombinant Human Thymic stromal lymphopoietin (TSLP)
Catalog Number:
CSB-MP025141HU
- Images (0)
| Article Name: | Recombinant Human Thymic stromal lymphopoietin (TSLP) |
| Biozol Catalog Number: | CSB-MP025141HU |
| Supplier Catalog Number: | CSB-MP025141HU |
| Alternative Catalog Number: | CSB-MP025141HU-1, CSB-MP025141HU-100, CSB-MP025141HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN,CSB-PR2024 |
| Molecular Weight: | 18.9 kDa |
| Tag: | N-terminal 6xHis-Myc-tagged |
| UniProt: | Q969D9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 29-159aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Product Guarantee and Expert Support
