Recombinant Human Vascular endothelial growth factor A (VEGFA),Biotinylated
Catalog Number:
CSB-MP025833HU(F4)-B
- Images (0)
| Article Name: | Recombinant Human Vascular endothelial growth factor A (VEGFA),Biotinylated |
| Biozol Catalog Number: | CSB-MP025833HU(F4)-B |
| Supplier Catalog Number: | CSB-MP025833HU(F4)-B |
| Alternative Catalog Number: | CSB-MP025833HU(F4)-B-1, CSB-MP025833HU(F4)-B-100, CSB-MP025833HU(F4)-B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | VEGF-A,Vascular permeability factor,VPF |
| Molecular Weight: | 22.7 kDa |
| Tag: | N-terminal Avi-G4S-tagged |
| UniProt: | P15692 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 27-191aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Product Guarantee and Expert Support
