Recombinant Human Short transient receptor potential channel 6 (TRPC6), partial
Catalog Number:
CSB-MP1339HU
- Images (0)
| Article Name: | Recombinant Human Short transient receptor potential channel 6 (TRPC6), partial |
| Biozol Catalog Number: | CSB-MP1339HU |
| Supplier Catalog Number: | CSB-MP1339HU |
| Alternative Catalog Number: | CSB-MP1339HU-1, CSB-MP1339HU-100, CSB-MP1339HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (TrpC6)(Transient receptor protein 6)(TRP-6),CSB-PR2024 |
| Molecular Weight: | 34.7 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q9Y210 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 543-592aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ |
Product Guarantee and Expert Support
