Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)
Catalog Number:
CSB-MP301425RB
- Images (0)
| Article Name: | Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) |
| Biozol Catalog Number: | CSB-MP301425RB |
| Supplier Catalog Number: | CSB-MP301425RB |
| Alternative Catalog Number: | CSB-MP301425RB-1, CSB-MP301425RB-100, CSB-MP301425RB-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Adenosine 5-monophosphoramidase P13.7,CSB-PR2024 |
| Molecular Weight: | 17.6 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P80912 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 2-126aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG |
Product Guarantee and Expert Support
