Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1)
Catalog Number:
CSB-MP317177ENV
- Images (0)
| Article Name: | Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) |
| Biozol Catalog Number: | CSB-MP317177ENV |
| Supplier Catalog Number: | CSB-MP317177ENV |
| Alternative Catalog Number: | CSB-MP317177ENV-1, CSB-MP317177ENV-100, CSB-MP317177ENV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | insE1, b0298, JW5036, Transposase InsE for insertion sequence IS3A |
| Molecular Weight: | 37.5 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | P0CF66 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-99aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK |
Product Guarantee and Expert Support
