Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1
Catalog Number:
CSB-MP317987VAK
- Images (0)
| Article Name: | Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1 |
| Biozol Catalog Number: | CSB-MP317987VAK |
| Supplier Catalog Number: | CSB-MP317987VAK |
| Alternative Catalog Number: | CSB-MP317987VAK-1, CSB-MP317987VAK-100, CSB-MP317987VAK-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Toxin Vm24 Toxin alpha-KTx 21.1 |
| Molecular Weight: | 7.9 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P0DJ31 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-36aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC |
Product Guarantee and Expert Support
