Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial
Catalog Number:
CSB-MP318280ARV
- Images (0)
| Article Name: | Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial |
| Biozol Catalog Number: | CSB-MP318280ARV |
| Supplier Catalog Number: | CSB-MP318280ARV |
| Alternative Catalog Number: | CSB-MP318280ARV-1, CSB-MP318280ARV-100, CSB-MP318280ARV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | pp1ab,ORF1ab polyprotein |
| Molecular Weight: | 26.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P12723 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-219aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ |
Product Guarantee and Expert Support
