Recombinant Porcine parvovirus Capsid protein VP1, partial

Catalog Number: CSB-MP323858PQB
Article Name: Recombinant Porcine parvovirus Capsid protein VP1, partial
Biozol Catalog Number: CSB-MP323858PQB
Supplier Catalog Number: CSB-MP323858PQB
Alternative Catalog Number: CSB-MP323858PQB-1, CSB-MP323858PQB-100, CSB-MP323858PQB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Coat protein VP1
Molecular Weight: 26.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P18546
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-207aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKETEHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKAKGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGE