Recombinant Viscum album Viscotoxin-A2 (THI2.3)
Catalog Number:
CSB-MP329208VDO
- Images (0)
| Article Name: | Recombinant Viscum album Viscotoxin-A2 (THI2.3) |
| Biozol Catalog Number: | CSB-MP329208VDO |
| Supplier Catalog Number: | CSB-MP329208VDO |
| Alternative Catalog Number: | CSB-MP329208VDO-1, CSB-MP329208VDO-100, CSB-MP329208VDO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 34.4 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | P32880 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-46aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK |
Product Guarantee and Expert Support
