Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N,E484K,N501Y), partial

Catalog Number: CSB-MP3324GMY(M6)H8
Article Name: Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N,E484K,N501Y), partial
Biozol Catalog Number: CSB-MP3324GMY(M6)H8
Supplier Catalog Number: CSB-MP3324GMY(M6)h8
Alternative Catalog Number: CSB-MP3324GMY(M6)H8-1, CSB-MP3324GMY(M6)H8-100, CSB-MP3324GMY(M6)H8-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (S glycoprotein)(E2)(Peplomer protein),CSB-PR2024
Molecular Weight: 104.4 kDa
Tag: C-terminal mFc-tagged
UniProt: P0DTC2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 16-685aa(K417N,E484K,N501Y)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY