Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (G75V,T76I,SYLTPGD247-253del,L452Q,F490S,D614G,T859N), partial

Product Overview

• Article Name: Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (G75V,T76I,SYLTPGD247-253del,L452Q,F490S,D614G,T859N), partial
• Biozol Catalog Number: CSB-MP3324GMY(M7)
• Supplier Catalog Number: CSB-MP3324GMY(M7)
• Alternative Catalog Number: CSB-MP3324GMY(M7)-1, CSB-MP3324GMY(M7)-100, CSB-MP3324GMY(M7)-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)

Product Properties

• Molecular Weight: 78.9 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged
• UniProt: P0DTC2
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian cell
• Expression System: 16-685aa(G75V,T76I,SYLTPGD247-253del,L452Q,F490S,D614G,T859N)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNVIKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSSSGWTAGAAAYYVGYLQPRTFL