Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (L452Q,F490S), partial
Catalog Number:
CSB-MP3324GMY1(M12)
- Images (0)
| Article Name: | Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (L452Q,F490S), partial |
| Biozol Catalog Number: | CSB-MP3324GMY1(M12) |
| Supplier Catalog Number: | CSB-MP3324GMY1(M12) |
| Alternative Catalog Number: | CSB-MP3324GMY1(M12)-1, CSB-MP3324GMY1(M12)-100, CSB-MP3324GMY1(M12)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2) |
| Molecular Weight: | 30.1 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P0DTC2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 319-541aa(L452Q,F490S) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYQYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYSPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Product Guarantee and Expert Support
