Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N,E484K,N501Y), partial
Catalog Number:
CSB-MP3324GMY1(M9)H8
- Images (0)
| Article Name: | Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N,E484K,N501Y), partial |
| Biozol Catalog Number: | CSB-MP3324GMY1(M9)H8 |
| Supplier Catalog Number: | CSB-MP3324GMY1(M9)h8 |
| Alternative Catalog Number: | CSB-MP3324GMY1(M9)H8-1, CSB-MP3324GMY1(M9)H8-100, CSB-MP3324GMY1(M9)H8-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (S glycoprotein)(E2)(Peplomer protein),CSB-PR2024 |
| Molecular Weight: | 54.4 kDa |
| Tag: | C-terminal mFc-tagged |
| UniProt: | P0DTC2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 319-541aa(K417T) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Product Guarantee and Expert Support
