Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
Catalog Number:
CSB-MP333180HFD
- Images (0)
| Article Name: | Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial |
| Biozol Catalog Number: | CSB-MP333180HFD |
| Supplier Catalog Number: | CSB-MP333180HFD |
| Alternative Catalog Number: | CSB-MP333180HFD-1, CSB-MP333180HFD-100, CSB-MP333180HFD-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC |
| Molecular Weight: | 18.7 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | P26664 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 192-325aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN |
Product Guarantee and Expert Support
