Recombinant Mouse Carboxylesterase 1C (Ces1c), partial
Catalog Number:
CSB-MP338557MO
- Images (0)
| Article Name: | Recombinant Mouse Carboxylesterase 1C (Ces1c), partial |
| Biozol Catalog Number: | CSB-MP338557MO |
| Supplier Catalog Number: | CSB-MP338557MO |
| Alternative Catalog Number: | CSB-MP338557MO-1, CSB-MP338557MO-100, CSB-MP338557MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Liver carboxylesterase N)(Lung surfactant convertase)(PES-N) |
| Molecular Weight: | 63.6 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P23953 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 19-550aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQ |
Product Guarantee and Expert Support
