Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
Catalog Number:
CSB-MP3388GND
- Images (0)
| Article Name: | Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) |
| Biozol Catalog Number: | CSB-MP3388GND |
| Supplier Catalog Number: | CSB-MP3388GND |
| Alternative Catalog Number: | CSB-MP3388GND-1, CSB-MP3388GND-100, CSB-MP3388GND-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Non-structural protein 9,CSB-PR2024 |
| Molecular Weight: | 44.5 kDa |
| Tag: | C-terminal hFc-Flag-tagged |
| UniProt: | P0DTD1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-113aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
Product Guarantee and Expert Support
