Recombinant Porphyromonas gingivalis Gingipain R1 (rgpA), partial

Catalog Number: CSB-MP338957PQP
Article Name: Recombinant Porphyromonas gingivalis Gingipain R1 (rgpA), partial
Biozol Catalog Number: CSB-MP338957PQP
Supplier Catalog Number: CSB-MP338957PQP
Alternative Catalog Number: CSB-MP338957PQP-1, CSB-MP338957PQP-100, CSB-MP338957PQP-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: rgpA, rgp1Gingipain R1, EC 3.4.22.37, Arg-gingipain, Gingipain 1, RGP-1
Molecular Weight: 58 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P28784
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 228-720aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMP