Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated
Catalog Number:
CSB-MP346571LIV(A4)-B
- Images (0)
| Article Name: | Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated |
| Biozol Catalog Number: | CSB-MP346571LIV(A4)-B |
| Supplier Catalog Number: | CSB-MP346571LIV(A4)-B |
| Alternative Catalog Number: | CSB-MP346571LIV(A4)-B-1, CSB-MP346571LIV(A4)-B-100, CSB-MP346571LIV(A4)-B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (CP)(VP1),CSB-PR2024 |
| Molecular Weight: | 64.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-avi-tagged |
| UniProt: | P54635 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-539aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGGFEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPDVRNNFYHYNQANDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPPTVESRTKPFTVPVLTVEEMSNSRFPIPLEKLYTGPS |
Product Guarantee and Expert Support
