Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial
Catalog Number:
CSB-MP357412MO
- Images (0)
| Article Name: | Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial |
| Biozol Catalog Number: | CSB-MP357412MO |
| Supplier Catalog Number: | CSB-MP357412MO |
| Alternative Catalog Number: | CSB-MP357412MO-1, CSB-MP357412MO-100, CSB-MP357412MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Fc-gamma RIII Short name: FcRIII CD_antigen: CD16,CSB-PR2024 |
| Molecular Weight: | 25.2 kDa |
| Tag: | N-terminal 6xHis-Myc-tagged |
| UniProt: | P08508 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 31-215aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT |
Product Guarantee and Expert Support
