Recombinant Hantaan virus Envelopment polyprotein (GP), partial
Catalog Number:
CSB-MP357454HCB1
- Images (0)
| Article Name: | Recombinant Hantaan virus Envelopment polyprotein (GP), partial |
| Biozol Catalog Number: | CSB-MP357454HCB1 |
| Supplier Catalog Number: | CSB-MP357454HCB1 |
| Alternative Catalog Number: | CSB-MP357454HCB1-1, CSB-MP357454HCB1-100, CSB-MP357454HCB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Glycoprotein precursor)(M polyprotein) |
| Molecular Weight: | 52.7 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P08668 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 649-1105aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTP |
Product Guarantee and Expert Support
