Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)

Product Overview

• Article Name: Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)
• Biozol Catalog Number: CSB-MP360437HU
• Supplier Catalog Number: CSB-MP360437HU
• Alternative Catalog Number: CSB-MP360437HU-1, CSB-MP360437HU-100, CSB-MP360437HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide

Product Properties

• Molecular Weight: 47.9 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: P00749
• Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
• Source: Mammalian cell
• Expression System: 21-431aa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHN

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration