Recombinant Bovine Odorant-binding protein
Catalog Number:
CSB-MP362133BO
- Images (0)
| Article Name: | Recombinant Bovine Odorant-binding protein |
| Biozol Catalog Number: | CSB-MP362133BO |
| Supplier Catalog Number: | CSB-MP362133BO |
| Alternative Catalog Number: | CSB-MP362133BO-1, CSB-MP362133BO-100, CSB-MP362133BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Olfactory mucosa pyrazine-binding protein |
| Molecular Weight: | 22 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P07435 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-159aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE |
Product Guarantee and Expert Support
