Recombinant Escherichia coli malE&Human OPA3 (linked heterodimer) Protein
Catalog Number:
CSB-MP3848
- Images (0)
| Article Name: | Recombinant Escherichia coli malE&Human OPA3 (linked heterodimer) Protein |
| Biozol Catalog Number: | CSB-MP3848 |
| Supplier Catalog Number: | CSB-MP3848 |
| Alternative Catalog Number: | CSB-MP3848-1, CSB-MP3848-100, CSB-MP3848-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ,CSB-PR2024 |
| Molecular Weight: | 60.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P0AEX9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | M+27-396(malE) & 103-179(OPA3) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQ |
Product Guarantee and Expert Support
