Recombinant Cat Interleukin-1 (IL1RN)
Catalog Number:
CSB-MP3932CA
- Images (0)
| Article Name: | Recombinant Cat Interleukin-1 (IL1RN) |
| Biozol Catalog Number: | CSB-MP3932CA |
| Supplier Catalog Number: | CSB-MP3932CA |
| Alternative Catalog Number: | CSB-MP3932CA-1, CSB-MP3932CA-100, CSB-MP3932CA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ,CSB-PR2024 |
| Molecular Weight: | 48.0 kDa |
| Tag: | N-terminal hFc-tagged |
| UniProt: | A0A337SPR9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-182aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRSWREKCFGNHKQFFQGQQGLPFGGETACHPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPSTKLEEKLNVVPIESHAMFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADRPVSLTNTPEEAMLVTKFYFQMER |
Product Guarantee and Expert Support
