Recombinant Macaca fascicularis NKG2A protein (nkg2A), partial
Catalog Number:
CSB-MP5045MOW
- Images (0)
| Article Name: | Recombinant Macaca fascicularis NKG2A protein (nkg2A), partial |
| Biozol Catalog Number: | CSB-MP5045MOW |
| Supplier Catalog Number: | CSB-MP5045MOW |
| Alternative Catalog Number: | CSB-MP5045MOW-1, CSB-MP5045MOW-100, CSB-MP5045MOW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 18.7 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q68VD2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 94-233aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PSTLTQKHNNSSLNTRTQKACHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTLKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSQHPWVTINGLTFKHEIKDSDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL |
Product Guarantee and Expert Support
