Recombinant Cowpox virus 14 kDa protein (A27L)
Catalog Number:
CSB-MP5087CRF
- Images (0)
| Article Name: | Recombinant Cowpox virus 14 kDa protein (A27L) |
| Biozol Catalog Number: | CSB-MP5087CRF |
| Supplier Catalog Number: | CSB-MP5087CRF |
| Alternative Catalog Number: | CSB-MP5087CRF-1, CSB-MP5087CRF-100, CSB-MP5087CRF-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 14 kDa protein,14K membrane protein,14kDa fusion protein ,CPXV162 protein ,IMV membrane protein |
| Molecular Weight: | 14.4 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q66272 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-110aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKAEGDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Product Guarantee and Expert Support
