Recombinant Cowpox virus Protein OPG161, partial
Catalog Number:
CSB-MP5089CRF
- Images (0)
| Article Name: | Recombinant Cowpox virus Protein OPG161, partial |
| Biozol Catalog Number: | CSB-MP5089CRF |
| Supplier Catalog Number: | CSB-MP5089CRF |
| Alternative Catalog Number: | CSB-MP5089CRF-1, CSB-MP5089CRF-100, CSB-MP5089CRF-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 15.6 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | G0XSP8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 58-185aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
Product Guarantee and Expert Support
