Recombinant Human LIR-1 (LILRB1), partial, Biotinylated
Catalog Number:
CSB-MP5114HU-B
- Images (0)
| Article Name: | Recombinant Human LIR-1 (LILRB1), partial, Biotinylated |
| Biozol Catalog Number: | CSB-MP5114HU-B |
| Supplier Catalog Number: | CSB-MP5114HU-B |
| Alternative Catalog Number: | CSB-MP5114HU-B-1, CSB-MP5114HU-B-100, CSB-MP5114HU-B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 76.7 kDa |
| Tag: | C-terminal hFc-Avi-tagged |
| UniProt: | D9IDM8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 24-458aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGL |
Product Guarantee and Expert Support
