Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5),partial (Active)

Catalog Number: CSB-MP5152MOW
Article Name: Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5),partial (Active)
Biozol Catalog Number: CSB-MP5152MOW
Supplier Catalog Number: CSB-MP5152MOW
Alternative Catalog Number: CSB-MP5152MOW-1, CSB-MP5152MOW-100, CSB-MP5152MOW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 76.9 kDa
Tag: C-terminal 10xHis-tagged
UniProt: XP_005589491.1
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Mammalian cell
Expression System: 1-685aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGEN
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration