Recombinant Bovine Pentraxin-related protein PTX3 (PTX3)
Catalog Number:
CSB-MP610820BO
- Images (0)
| Article Name: | Recombinant Bovine Pentraxin-related protein PTX3 (PTX3) |
| Biozol Catalog Number: | CSB-MP610820BO |
| Supplier Catalog Number: | CSB-MP610820BO |
| Alternative Catalog Number: | CSB-MP610820BO-1, CSB-MP610820BO-100, CSB-MP610820BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Pentaxin-related protein PTX3 |
| Molecular Weight: | 44.7 kDa |
| Tag: | N-terminal Flag-Myc-tagged |
| UniProt: | Q0VCG9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 18-382aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRENSEWDKLFTMLENSQMREGMLLQATDVMLRGELQKLQAELGRLEGSLQKLCGPEAPSETRLARALDDLLQASRDAGRRLARLEDAGALRPQEEAGRALGAVLEELRRTRADLRAVQGWAASRWLPAGCETAILFPMRSKKIFASVHPVTPMKLETFSACIWVKATEVLNKTVLFSYGTKRNPYEIQLYLSYRSIMLVVGGEENRLVADAVISLGTWTHL |
Product Guarantee and Expert Support
