Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial
Catalog Number:
CSB-MP611894HIWH8
- Images (0)
| Article Name: | Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial |
| Biozol Catalog Number: | CSB-MP611894HIWH8 |
| Supplier Catalog Number: | CSB-MP611894HIWh8 |
| Alternative Catalog Number: | CSB-MP611894HIWH8-1, CSB-MP611894HIWH8-100, CSB-MP611894HIWH8-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | E2 Peplomer protein |
| Molecular Weight: | 64.1 kDa |
| Tag: | C-terminal mFc-tagged |
| UniProt: | Q0ZME7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 310-622aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNLSSYDVVYSDHCFSVNSDFCPCADPSVVNSCAKSKPPSAICPAGTKYRHCDLDTTLYVKNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHS |
Product Guarantee and Expert Support
