Recombinant Human Guanylate cyclase activator 2B (GUCA2B)
Catalog Number:
CSB-MP613693HU
- Images (0)
| Article Name: | Recombinant Human Guanylate cyclase activator 2B (GUCA2B) |
| Biozol Catalog Number: | CSB-MP613693HU |
| Supplier Catalog Number: | CSB-MP613693HU |
| Alternative Catalog Number: | CSB-MP613693HU-1, CSB-MP613693HU-100, CSB-MP613693HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Guanylate cyclase C-activating peptide II ,GCAP-IIUroguanylin ,UGN,CSB-PR2024 |
| Molecular Weight: | 13.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q16661 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 27-112aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
Product Guarantee and Expert Support
