Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial
Catalog Number:
CSB-MP614402HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial |
| Biozol Catalog Number: | CSB-MP614402HU |
| Supplier Catalog Number: | CSB-MP614402HU |
| Alternative Catalog Number: | CSB-MP614402HU-1, CSB-MP614402HU-100, CSB-MP614402HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IL-15 receptor subunit alpha)(IL-15R-alpha)(IL-15RA)(CD antigen CD215)(sIL-15 receptor subunit alpha)(sIL-15R-alpha)(sIL-15RA),CSB-PR2024 |
| Molecular Weight: | 47.3 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q13261 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 31-205aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
Product Guarantee and Expert Support
