Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial
Catalog Number:
CSB-MP618776HU
- Images (0)
| Article Name: | Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial |
| Biozol Catalog Number: | CSB-MP618776HU |
| Supplier Catalog Number: | CSB-MP618776HU |
| Alternative Catalog Number: | CSB-MP618776HU-1, CSB-MP618776HU-100, CSB-MP618776HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Short name: MAdCAM-1 Short name: hMAdCAM-1,CSB-PR2024 |
| Molecular Weight: | 34.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q13477 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 19-317aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEP |
Product Guarantee and Expert Support
