Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial

Catalog Number: CSB-MP619640HU
Article Name: Recombinant Human Vesicular integral-membrane protein VIP36 (LMAN2), partial
Biozol Catalog Number: CSB-MP619640HU
Supplier Catalog Number: CSB-MP619640HU
Alternative Catalog Number: CSB-MP619640HU-1, CSB-MP619640HU-100, CSB-MP619640HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Glycoprotein GP36b)(Lectin mannose-binding 2)(Vesicular integral-membrane protein 36)(VIP36),CSB-PR2024
Molecular Weight: 36.0 kDa
Tag: N-terminal 6xHis-HA-tagged
UniProt: Q12907
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 45-322aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNF