Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Product Overview

• Article Name: Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)
• Biozol Catalog Number: CSB-MP620956HUD9
• Supplier Catalog Number: CSB-MP620956HUd9
• Alternative Catalog Number: CSB-MP620956HUD9-1, CSB-MP620956HUD9-100, CSB-MP620956HUD9-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (IBP-7)(IGF-binding protein 7)(IGFBP-7)(IGFBP-rP1)(MAC25 protein)(PGI2-stimulating factor)(Prostacyclin-stimulating factor)(Tumor-derived adhesion factor)(TAF),CSB-PR2024

Product Properties

• Molecular Weight: 55.4 kDa
• Tag: C-terminal hFc-tagged
• UniProt: Q16270
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian cell
• Expression System: 27-282aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGA