Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial
Catalog Number:
CSB-MP623780HU
- Images (0)
| Article Name: | Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial |
| Biozol Catalog Number: | CSB-MP623780HU |
| Supplier Catalog Number: | CSB-MP623780HU |
| Alternative Catalog Number: | CSB-MP623780HU-1, CSB-MP623780HU-100, CSB-MP623780HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 180KDA secretory phospholipase A2 receptor C-type lectin domain family 13 member C M-type receptor |
| Molecular Weight: | 19.4 kDa |
| Tag: | N-terminal 6xHis-Myc-tagged |
| UniProt: | Q13018 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 395-530aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
Product Guarantee and Expert Support
