Recombinant Bovine Pregnancy-associated glycoprotein 1
Catalog Number:
CSB-MP644917BO
- Images (0)
| Article Name: | Recombinant Bovine Pregnancy-associated glycoprotein 1 |
| Biozol Catalog Number: | CSB-MP644917BO |
| Supplier Catalog Number: | CSB-MP644917BO |
| Alternative Catalog Number: | CSB-MP644917BO-1, CSB-MP644917BO-100, CSB-MP644917BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Pregnancy-specific protein B,PSP-B |
| Molecular Weight: | 65.6 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q29432 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 54-380aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVN |
Product Guarantee and Expert Support
