Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)
Catalog Number:
CSB-MP663623MO
- Images (0)
| Article Name: | Recombinant Mouse Putative phospholipase B-like 2 (Plbd2) |
| Biozol Catalog Number: | CSB-MP663623MO |
| Supplier Catalog Number: | CSB-MP663623MO |
| Alternative Catalog Number: | CSB-MP663623MO-1, CSB-MP663623MO-100, CSB-MP663623MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 66.3KDA protein76KDA protein ,p76LAMA-like protein 2Lamina ancestor homolog 2,Phospholipase B domain-containing protein 2 |
| Molecular Weight: | 65.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q3TCN2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 47-594aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGN |
Product Guarantee and Expert Support
