Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial
Catalog Number:
CSB-MP663649MO
- Images (0)
| Article Name: | Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial |
| Biozol Catalog Number: | CSB-MP663649MO |
| Supplier Catalog Number: | CSB-MP663649MO |
| Alternative Catalog Number: | CSB-MP663649MO-1, CSB-MP663649MO-100, CSB-MP663649MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Transmembrane protein 149),CSB-PR2024 |
| Molecular Weight: | 44.2 kDa |
| Tag: | C-terminal hFC-tagged |
| UniProt: | Q3U4N7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 21-163aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSAS |
Product Guarantee and Expert Support
