Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1),partial
Catalog Number:
CSB-MP689809HU
- Images (0)
| Article Name: | Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1),partial |
| Biozol Catalog Number: | CSB-MP689809HU |
| Supplier Catalog Number: | CSB-MP689809HU |
| Alternative Catalog Number: | CSB-MP689809HU-1, CSB-MP689809HU-100, CSB-MP689809HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (CCP module-containing protein 22)(Polydom)(Selectin-like osteoblast-derived protein)(SEL-OB)(Serologically defined breast cancer antigen NY-BR-38) |
| Molecular Weight: | 39.5 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q4LDE5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 736-827aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG |
Product Guarantee and Expert Support
