Recombinant Human Mucin-16 (MUC16), partial

Catalog Number: CSB-MP704410HU3
Article Name: Recombinant Human Mucin-16 (MUC16), partial
Biozol Catalog Number: CSB-MP704410HU3
Supplier Catalog Number: CSB-MP704410HU3
Alternative Catalog Number: CSB-MP704410HU3-1, CSB-MP704410HU3-100, CSB-MP704410HU3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Ovarian cancer-related tumor marker CA125 (CA-125) (Ovarian carcinoma antigen CA125)
Molecular Weight: 58.5 kDa
Tag: C-terminal FC-Myc-tagged
UniProt: Q8WXI7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 12660-12923aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLR