Recombinant Human Inducible T-cell costimulator (ICOS), partial
Catalog Number:
CSB-MP707478HU
- Images (0)
| Article Name: | Recombinant Human Inducible T-cell costimulator (ICOS), partial |
| Biozol Catalog Number: | CSB-MP707478HU |
| Supplier Catalog Number: | CSB-MP707478HU |
| Alternative Catalog Number: | CSB-MP707478HU-1, CSB-MP707478HU-100, CSB-MP707478HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Activation-inducible lymphocyte immunomediatory molecule |
| Molecular Weight: | 42.7 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q9Y6W8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 21-141aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF |
Product Guarantee and Expert Support
