Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)-VLPs (Active)
Catalog Number:
CSB-MP711093HU
- Images (0)
| Article Name: | Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)-VLPs (Active) |
| Biozol Catalog Number: | CSB-MP711093HU |
| Supplier Catalog Number: | CSB-MP711093HU |
| Alternative Catalog Number: | CSB-MP711093HU-1, CSB-MP711093HU-100, CSB-MP711093HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (KK-LC-1)(Cancer/testis antigen 83) |
| Molecular Weight: | 14 kDa |
| Tag: | N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions) |
| UniProt: | Q5H943 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Mammalian cell |
| Expression System: | 1-113aa |
| Purity: | Testing in progress. |
| Form: | Lyophilized powder |
| Sequence: | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Product Guarantee and Expert Support
