Recombinant Mouse Insulin-like growth factor-binding protein 7 (Igfbp7)
Catalog Number:
CSB-MP713980MO
- Images (0)
| Article Name: | Recombinant Mouse Insulin-like growth factor-binding protein 7 (Igfbp7) |
| Biozol Catalog Number: | CSB-MP713980MO |
| Supplier Catalog Number: | CSB-MP713980MO |
| Alternative Catalog Number: | CSB-MP713980MO-1, CSB-MP713980MO-100, CSB-MP713980MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IBP-7)(IGF-binding protein 7)(IGFBP-7)(MAC25 protein),CSB-PR2024 |
| Molecular Weight: | 55.3 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q61581 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 26-281aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGA |
Product Guarantee and Expert Support
