Recombinant Human Fc receptor-like protein 6 (FCRL6), partial
Catalog Number:
CSB-MP718779HU
- Images (0)
| Article Name: | Recombinant Human Fc receptor-like protein 6 (FCRL6), partial |
| Biozol Catalog Number: | CSB-MP718779HU |
| Supplier Catalog Number: | CSB-MP718779HU |
| Alternative Catalog Number: | CSB-MP718779HU-1, CSB-MP718779HU-100, CSB-MP718779HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Fc receptor homolog 6 (FcRH6) (IFGP6) |
| Molecular Weight: | 35.2 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q6DN72 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 20-307aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGN |
Product Guarantee and Expert Support
