Recombinant Mouse Ubiquitin-like protein ISG15 (Isg15)
Catalog Number:
CSB-MP723739MO
- Images (0)
| Article Name: | Recombinant Mouse Ubiquitin-like protein ISG15 (Isg15) |
| Biozol Catalog Number: | CSB-MP723739MO |
| Supplier Catalog Number: | CSB-MP723739MO |
| Alternative Catalog Number: | CSB-MP723739MO-1, CSB-MP723739MO-100, CSB-MP723739MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Interferon-induced 15 kDa protein)(Interferon-induced 17 kDa protein)(IP17)(Ubiquitin cross-reactive protein) |
| Molecular Weight: | 19.2 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q64339 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 1-155aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG |
Product Guarantee and Expert Support
