Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial
Catalog Number:
CSB-MP723744MO
- Images (0)
| Article Name: | Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial |
| Biozol Catalog Number: | CSB-MP723744MO |
| Supplier Catalog Number: | CSB-MP723744MO |
| Alternative Catalog Number: | CSB-MP723744MO-1, CSB-MP723744MO-100, CSB-MP723744MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II) |
| Molecular Weight: | 29.5 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q64514 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 44-264aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
Product Guarantee and Expert Support
